Ionotropic Glutamate Receptor 5

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ionotropic Glutamate Receptor 5
  Conformer 1
(PDB) 		2f35 (A)
  Conformer 2
(PDB) 		2qs4 (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 146 0.94   6 - 89   92 - 107   197 - 204   215 - 252
2 101 0.89   90 - 91   108 - 196   205 - 214

Sequence


           ____________________________________________________________________________________89_______________107________________ 
 2f35(A) : RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
         :                                                                                                                          
 2qs4(D) : RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFLYDVKLVPDGKYGAQNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKGTPIDSA 
           ____________________________________________________________________________________89_______________107________________ 

           ______________________________________________________________________196_____204_______214_____________________________ 
 2f35(A) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL 
         :                                                                                                                          
 2qs4(D) : DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL 
           ______________________________________________________________________196_____204_______214_____________________________ 

           _____________                                                                                                            
 2f35(A) : HMMKEKWWRGN**                                                                                                            
         :                                                                                                                          
 2qs4(D) : HMMKEKWWRGNGC                                                                                                            
           _____________                                                                                                            

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		8.6
Translation
(A) 		0.0
Closure
(%) 		74.2
Bending Residues
( green ) 		  89 - 92
  107 - 108
  196 - 197
  204 - 205
  214 - 215
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download