Ig Gamma-2a Chain C Region

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Ig Gamma-2a Chain C Region
  Conformer 1
(PDB) 		1i1c (B)
  Conformer 2
(PDB) 		1i1a (D)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 128 1.22   241 - 246   248 - 250   259 - 259   275 - 275   277 - 283   322 - 323   334 - 441
2 73 1.74   247 - 247   251 - 258   260 - 274   276 - 276   284 - 321   324 - 333

Sequence


           _________________258____________273_______283___________________________________321__326________________________________ 
 1i1c(B) : SVFIFPPKTKDVLGGGLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVERDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEM 
         :                                                                                                                          
 1i1a(D) : SVFIFPPKTKDVLGGGLTPKVTCVVVDISQNDPEVRFSWFIDDVEVHTAQTHAPEKQSNSTLRSVSELPIVERDWLNGKTFKCKVNSGAFPAPIEKSISKPEGTPRGPQVYTMAPPKEEM 
           _________________258____________273_______283___________________________________321__326________________________________ 

           _____________________________________________________________________________________                                    
 1i1c(B) : TQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLENEHTEKSLSH                                    
         :                                                                                                                          
 1i1a(D) : TQSQVSITCMVKGFYPPDIYTEWKMNGQPQENYKNTPPTMDTDGSYFLYSKLNVKKETWQQGNTFTCSVLHEGLENEHTEKSLSH                                    
           _____________________________________________________________________________________                                    

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		23.8
Translation
(A) 		0.7
Closure
(%) 		8.4
Bending Residues
( green ) 		  241 - 251
  258 - 260
  273 - 277
  283 - 284
  321 - 324
  326 - 335
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download