Major Prion Protein

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Major Prion Protein
  Conformer 1
(PDB) 		3hjx (A)
  Conformer 2
(PDB) 		3hak (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 53 1.03   128 - 131   136 - 144   161 - 189   210 - 220
2 31 0.65   132 - 135   145 - 160   199 - 209

Sequence


           ____131__________144_____________160__________________________189_________________209__________________                  
 3hjx(A) : *GGYVLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHNCVNITIKQHTVTTT---eNFTETDVKMMERVVEQMCITQYERESQ****                  
         :                                                                                                                          
 3hak(A) : LGGYVLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQ                  
           ____131__________144_____________160__________________________189_________________209__________________                  

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		17.6
Translation
(A) 		-0.3
Closure
(%) 		82.7
Bending Residues
( green ) 		  131 - 136
  144 - 145
  160 - 161
  189 - 199
  209 - 210
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download