Peptidyl-Prolyl Cis-Trans Isomerase Slyd

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Peptidyl-Prolyl Cis-Trans Isomerase Slyd
  Conformer 1
(PDB) 		4odk (A)
  Conformer 2
(PDB) 		4odo (B)
  Window Length 7
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 31 0.44   15 - 23   61 - 73   118 - 126
2 71 0.32   4 - 14   24 - 60   127 - 149
3 41 0.51   74 - 117

Sequence


           ____________14_______23___________________________________60___________73_________________________________________117___ 
 4odk(A) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQD---nPMPLTVVAVEGEEVTVDFNHP 
         :                                                                                                                          
 4odo(B) : MKVGQDKVVTIRYTLQVEGEVLDQGELSYLHGHRNLIPGLEEALEGREEGEAFQAHVPAEKAYGPHDPEGVQVVPLSAFPEDAEVVPGAQFYAQDMEGNPMPLTVVAVEGEEVTVDFNHP 
           ____________14_______23___________________________________60___________73_________________________________________117___ 

           ___126______________________________                                                                                     
 4odk(A) : LAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHHH                                                                                     
         :                                                                                                                          
 4odo(B) : LAGKDLDFQVEVVKVREATPEELLHGHAHPSGHHH*                                                                                     
           ___126______________________________                                                                                     

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		7.2
Translation
(A) 		-0.1
Closure
(%) 		71.2
Bending Residues
( green ) 		  14 - 15
  23 - 25
  60 - 61
  126 - 127
Bending Region Analysis
Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( yellow ) 		3
Rotation Angle
(deg) 		7.3
Translation
(A) 		0.3
Closure
(%) 		0.2
Bending Residues
( green ) 		  73 - 74
  117 - 119
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification:

No Contacts

Conformer 1 Contact:
Residue 1 ———› Residue 3

Conformer 2 Contact:
Residue 3 ———› Residue 1

Movement classification: Shear

PyMOL Script

Download and extract PyMOL PML script file Download