P-Selectin

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name P-Selectin
  Conformer 1
(PDB) 		1g1s (A)
  Conformer 2
(PDB) 		1g1t (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 117 1.61   3 - 119
2 36 0.67   120 - 155

Sequence


           ___________________________________________________________________________________________________________________118__ 
 1g1s(A) : WTYHYSTKAYSWNISRKYCQNRYTDLVAIQNKNEIDYLNKVLPYYSSYYWIGIRKNNKTWTWVGTKKALTNEAENWADNEPNNKRNNEDCVEIYIKSPSAPGKWNDEHCLKKKHALCYTA 
         :                                                                                                                          
 1g1t(A) : WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTA 
           ___________________________________________________________________________________________________________________118__ 

           ______________________________________                                                                                   
 1g1s(A) : SCQDMSCSKQGECLETIGNYTCSCYPGFYGPECEYVRD                                                                                   
         :                                                                                                                          
 1g1t(A) : ACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIV*                                                                                   
           ______________________________________                                                                                   

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		49.7
Translation
(A) 		0.2
Closure
(%) 		94.9
Bending Residues
( green ) 		  118 - 126
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download