Regulator Of Macrolide 2'-Phosphotransferase I

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Regulator Of Macrolide 2'-Phosphotransferase I
  Conformer 1
(PDB) 		3g56 (A)
  Conformer 2
(PDB) 		3frq (A)
  Window Length 5
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 128 0.73   24 - 27   61 - 187
2 47 0.59   10 - 23   28 - 60

Sequence


           _________________23__27______________________________59_________________________________________________________________ 
 3g56(A) : ***SDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMN---dFSVNYLISWYELQVPELRTLAIQRNR 
         :                                                                                                                          
 3frq(A) : KLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALIQRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMNTRNDFSVNYLISWYELQVPELRTLAIQRNR 
           _________________23__27______________________________59_________________________________________________________________ 

           __________________________________________________________________                                                       
 3g56(A) : AVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQLL                                                       
         :                                                                                                                          
 3frq(A) : AVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDGELADHVLAQIAAILCLMFPEHDDFQL*                                                       
           __________________________________________________________________                                                       

Morph

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		10.9
Translation
(A) 		0.4
Closure
(%) 		95.9
Bending Residues
( green ) 		  23 - 24
  27 - 28
  59 - 61
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Mixed

PyMOL Script

Download and extract PyMOL PML script file Download