Regulator Of Sigma E Protease

(All numbering and residues are taken from first PDB file)

Run Details Domains Sequence Morph Domain Pairs Contact Graph

DynDom run details

  Property   Value
  Name Regulator Of Sigma E Protease
  Conformer 1
(PDB) 		3id2 (A)
  Conformer 2
(PDB) 		3di3 (A)
  Window Length 11
  Minimum ratio 1.0
  Minimum domain size 20

Domains

Domain Size Backbone RMSD
(A)		 Residues
1 26 7.49   261 - 286
2 21 6.49   240 - 260

Sequence


           _________________________________________________________________260__________________________________________________   
 3id2(A) : ***************************HMIEPVLENVQPNSAASKAGLQAGDRIVKVDGQPLTQWVTFVMLVRDNPGKSLALEIERQGSPLSLTLIPESKPGNGKAIGFVGIEPKVI*   
         :                                                                                                                          
 3di3(A) : KDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGqKKLNDLCFLKRLLQEIKTCWNKILM   
           __________________________________________________________________74__________________________________________________   

Morph
Morph animation in progress.
Status: Initialising

This morph was created using the MorphIt_Pro protein morphing technique.
For more advanced options, right click on the model.


Show console


play backwards pause play forwards

Domain Pairs

Property Value
Fixed Domain
( blue ) 		1
Moving Domain
( red ) 		2
Rotation Angle
(deg) 		90.2
Translation
(A) 		1.9
Closure
(%) 		94.7
Bending Residues
( green ) 		  260 - 262
Bending Region Analysis

Dynamic Contact Graph

Conformer 1 Contact:
Residue 1 ———› Residue 2

Conformer 2 Contact:
Residue 2 ———› Residue 1

Movement classification: Hinge

PyMOL Script

Download and extract PyMOL PML script file Download